Vastasyntyneiden seulontaverinäyte

Vastasyntyneiltä otettavalla seulontaverinäytteellä seulotaan synnynnäisiä aineenvaihdunta- ja immuunipuutossairauksia. Nämä sairaudet ovat harvinaisia ja periytyviä. Ne ilmenevät yleensä varhaisessa imeväisiässä. Useimmat lapset, jotka sairastavat näitä harvinaisia sairauksia, vaikuttavat vastasyntyneinä täysin terveiltä. Hoitamattomina taudit voivat johtaa vaikeaan vammautumiseen tai kuolemaan. Oikea hoito onkin tärkeää aloittaa mahdollisimman varhain, jotta sairauden aiheuttamat haitat olisivat mahdollisimman vähäisiä.

Osa aineenvaihdunta- ja immuunipuutossairauksista voidaan todeta vastasyntyneestä otettavalla verinäytteellä. HUSin synnytyssairaaloissa tarjotaan kaikille vastasyntyneille vauvoille näiden sairauksien seulontaa. Ilman seulontaa näiden sairauksien tunnistaminen alkuvaiheessa on vaikeaa.

Seulottavat sairaudet ovat:

Vaikea kombinoitu immuunipuutos (SCID)

Aminohappojen aineenvaihdunnan sairaudet

  • Fenyyliketonuria (PKU)
  • Tyrosinemia tyyppi 1
  • Vaahterasiirappitauti (MSUD)
  • Homokystinuria
  • Hyperornitinemia ja gyrata-atrofia (HOGA)

Endokrinologiset sairaudet

  • Synnynnäinen lisämunuaisen liikakasvu (CAH)

 

Orgaanisten happojen aineenvaihdunnan häiriöt

  • Synnynnäinen B12-vitamiinin puutos
  • Glutaarihappovirtsaisuus tyyppi I (GA I)
  • Isovaleerihappovirtsaisuus
  • Metyylimalonihappovirtsaisuus
  • Propionihappovirtsaisuus

 

Rasvahappojen aineenvaihdunnan häiriöt

  • CACT (karnitiini-asyylikarnitiinitranslokaasin puutos)
  • CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I
  • CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II
  • CUD (karnitiinin kuljetushäiriö)
  • Glutaarihappovirtsaisuus tyyppi II (GA II)
  • MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)
  • LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency)
  • VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)

 

Ureasyklin häiriöt

  • Sitrullinemia
  • Arginiinimeripihkahappouria (ASA-uria)
  • Argininemia

 

Seulontaa varten verinäyte otetaan ihopistolla kantapäästä vauvan ollessa 2–5 vuorokauden (48–120 tunnin) ikäinen. Näyte otetaan synnyttäneiden osastolla tai lastenosastolla. Jos olette kotiutuneet ennen näytteenottoa, näyte otetaan erillisellä käynnillä sivun alareunassa mainituissa HUSLABin näytteenottopisteissä vauvan ollessa 2-5 vuorokauden ikäinen.

Näytteenottopisteet ovat avoinna arkipäivisin. Uuden lastensairaalan laboratorio on avoinna myös iltaisin klo 16–18 ja lauantaisin ilman ajanvarausta klo 9–14. Näytteenottoon voi tulla ilman ajanvarausta. Aamut ovat näytteenotoissa usein ruuhkaisia, joten suositeltavaa on tulla iltapäivällä. Useimpiin näytteenottopisteisiin voi myös varata ajan. Näytteenottoajan voi varata osoitteessa www.huslab.fi tai arkisin numerosta p. 09 471 86800.

Ottakaa mukaan synnytyskertomus 2 (SK 2) vauvan henkilötunnuksen tarkistamista ja näytteenoton nopeuttamista varten. Sen puuttuminen ei estä näytteenottoa.

Mikäli seulonnassa herää epäily jostain sairaudesta, olemme teihin yhteydessä. Jos seulottavia sairauksia ei löydy, tästä ei teille erikseen tiedoteta. Verikokeen tulos näkyy myös Omakannassa.

HUSLABin näytteenotot, joissa toimii vastasyntyneiden seulontanäytteenotto
Tullinpuomin
laboratorio
HUSLABin näytteenotto
Topeliuksenkatu 32
Helsinki
Naistenklinikka
HUSLABin näytteenotto
Haartmaninkatu 2, 2. kerros Helsinki​
Jorvin sairaala
HUSLABin näytteenotto
Turuntie 150, 1. kerros
opastus,pääaulasta
Espoo
Hyvinkään sairaala
HUSLABin näytteenotto
Sairaalankatu 1,1.kerros
Hyvinkää
Lohjan sairaala
HUSLABin
näytteenotto
Sairaalatie 8,
1. kerros
Lohja
Raaseporin sairaala
HUSLABin
näytteenotto
Itäinen Rantakatu 9
Tammisaari
​Porvoon sairaala
HUSLABin
näytteenotto
Sairaalatie 1
Porvoo
Uusi lastensairaala
HUSLABin näytteenotto
Stenbäckinkatu 9, 1. krs,
Helsinki

Ajanvaraus ja neuvonta: puhelimitse (09) 471 86800 arkisin klo 7.30-15.30

Ajanvaraus näytteenottoihin

Aukioloajat