Synnynnäisten aineenvaihduntasairauksien seulonta vastasyntyneiltä

Synnynnäiset aineenvaihduntasairaudet ovat harvinaisia, periytyviä sairauksia, jotka ilmenevät yleensä varhaisessa imeväisiässä. HUS:n synnytyssairaaloissa tarjotaan kaikille vastasyntyneille vauvoille harvinaisten synnynnäisten aineenvaihduntasairauksien seulontaa. Ilman seulontaa näiden sairauksien tunnistaminen alkuvaiheessa on vaikeaa. Useimmat lapset, jotka sairastavat näitä harvinaisia sairauksia, vaikuttavat vastasyntyneinä täysin terveiltä. Hoitamattomina taudit voivat johtaa vaikeaan vammautumiseen tai kuolemaan. Oikea hoito onkin tärkeää aloittaa mahdollisimman varhain, jotta sairauden aiheuttamat haitat olisivat mahdollisimman vähäisiä.

Seulottavat sairaudet ovat:

Aminohappojen aineenvaihdunnan sairaudet

  • Fenyyliketonuria (PKU)
  • Tyrosinemia tyyppi 1
  • Vaahterasiirappitauti (MSUD)


Endokrinologiset sairaudet

  • Synnynnäinen lisämunuaisen liikakasvu (CAH)


Orgaanisten happojen aineenvaihdunnan häiriöt

  • Synnynnäinen B12-vitamiinin puutos
  • Glutaarihappovirtsaisuus tyyppi I (GA I)
  • Isovaleerihappovirtsaisuus
  • Metyylimalonihappovirtsaisuus
  • Propionihappovirtsaisuus


Rasvahappojen aineenvaihdunnan häiriöt

  • CACT (karnitiini-asyylikarnitiinitranslokaasin puutos)
  • CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I
  • CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II
  • CUD (karnitiinin kuljetushäiriö)
  • Glutaarihappovirtsaisuus tyyppi II (GA II)
  • MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)
  • LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency)
  • VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)


Ureasyklin häiriöt

  • Sitrullinemia
  • Arginiinimeripihkahappouria (ASA-uria)
  • Argininemia


Seulonta tehdään muutamasta veritipasta, jotka otetaan ihopistolla kantapäästä vauvan ollessa 2-5 vuorokauden (48–120 tunnin) ikäinen. Laboratoriohoitaja ottaa näytteen lapsivuodeosastolla tai lastenosastolla. Jos olette kotiutuneet ennen näytteenottoa, näyte otetaan erillisellä käynnillä sivun alareunassa mainituissa HUSLAB:n näytteenotoissa vauvan ollessa 2-5 vuorokauden ikäinen.

Näytteenotot ovat avoinna arkisin. Näytteenottoon voi tulla joko ajanvarauksella tai ilman ajanvarausta. Kätilöopiston sairaalassa sijaitsevaan HUSLAB:n näytteenottoon ei voi tehdä ajanvarausta. Aamut ovat näytteenotoissa usein ruuhkaisia, joten suositeltavaa on tulla iltapäivällä. Näytteenottoajan voi varata joko sivuilta tai arkisin HUSLABin keskitetystä ajanvarausnumerosta p. 09 471 86800.

Mikäli mahdollista, ottakaa mukaan synnytyskertomus 2 (SK 2) vauvan henkilötunnuksen tarkistamista ja näytteenoton nopeuttamista varten. Sen puuttuminen ei estä näytteenottoa.

Mikäli seulonnassa herää epäily jostain sairaudesta, olemme teihin yhteydessä. Tällöin lapsi kutsutaan lääkärinvastaanotolle. Jos seulottavia sairauksia ei löydy, tästä ei teille erikseen tiedoteta.

HUSLAB:n näytteenotot, joissa toimii vastasyntyneiden seulontanäytteenotto
Jorvin sairaala
HUSLAB:n näytteenotto
Turuntie 150, 2. kerros
HUSLAB:n näytteenotto
Haartmaninkatu 2, 2. kerros Helsinki​
Hyvinkään sairaala
HUSLAB:n näytteenotto
Sairaalankatu 1,1.kerros

Lohjan sairaala
Sairaalatie 8,
1. kerros
Raaseporin sairaala
Itäinen Rantakatu 9
​Porvoon sairaala
Sairaalatie 1

Ajanvaraus ja neuvonta: puhelimitse (09) 471 86800 arkisin klo 7.30-15.30

Ajanvaraus näytteenottoihin (ei Kätilöopiston sairaala)
